FOXO4-DRI

Size: 10 mg
Form: Lyophilized powder
Purity: ≥ 99% (per COA)
COA: Linked per batch

$216.25

Buy more, pay less

5+ of the same compound — 10% off
11+ of the same compound — 20% off
any 3 different compounds — 20% off

Applied automatically in the cart. You always get the better of the two.

Build a stack of 3+ compounds for 20% off — your stack totals live in the bench tray, with the research-use-only acknowledgment captured at checkout.

For laboratory research use only · Not for human consumption

Research handling note

For laboratory research use only — not for human or veterinary use. Handle with appropriate PPE in a controlled lab setting. Store lyophilized material at -4 °F (-20 °C), protected from light and moisture; once reconstituted with bacteriostatic water, refrigerate and use within the documented window. Confirm identity and purity against the batch COA before use.

Quality & testing

Every batch is independently third-party tested for identity, mass, and purity, and ships with a lot code you can verify. How we test →

Verify a batch

Pairs well with

Complete the stack

Compounds researchers commonly explore alongside FOXO4-DRI. Build a stack of 5+ distinct compounds and 20% comes off the whole protocol (supplies excluded).

LongevityRUO

Cartalax

20 mg · Lyophilized powder

$62.50

LongevityRUO

Epitalon

10 mg · Lyophilized powder

$42.50

LongevityRUO

Humanin

5 mg · Lyophilized powder

$65.00

LongevityRUO

MOTS-c

10 mg · Lyophilized powder

$61.88

Pairings reflect compounds commonly researched together — not a protocol, combination guidance, or any therapeutic claim. Research use only.

Reference data

FOXO4-DRI is a synthetic all-D-amino-acid retro-inverso peptide derived from a FOXO4 sequence fused to a cell-penetrating motif.

Class: Synthetic D-retro-inverso peptide
Also known as: FOXO4 D-Retro-Inverso peptide · Proxofim
Molecular formula: C228H388N86O64
Molar mass: 5358.15 g/mol
CAS number: 2460055-10-9
Appearance: White to off-white lyophilized powder
Storage: Store lyophilized at -4 °F (-20 °C), protected from light. After reconstitution, keep refrigerated at 36–46 °F (2–8 °C).
Reconstitution: Soluble in bacteriostatic or sterile water.

Sequence

ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg (all-D, retro-inverso)

Authoritative references

Wikipedia: FOXO4-DRI PubChem

Reference data is provided for laboratory identification only. Values are sourced from public chemistry databases; confirm against the batch COA. Not for human or animal use.